Transcript Document
Natural Language Processing (8) Zhao Hai 赵海 Department of Computer Science and Engineering Shanghai Jiao Tong University 2010-2011 [email protected] 1 Overview • Models – HMM: Hidden Markov Model – maximum entropy Markov model – CRFs: Conditional Random Fields • Tasks – Chinese word segmentation – part-of-speech tagging – named entity recognition 2 What is an HMM? • Graphical Model • Circles indicate states • Arrows indicate probabilistic dependencies between states 3 What is an HMM? • Green circles are hidden states • Dependent only on the previous state • “The past is independent of the future given the present.” 4 What is an HMM? • Purple nodes are observed states • Dependent only on their corresponding hidden state 5 HMM Formalism S S S S S K K K K K • {S, K, P, A, B} • S : {s1…sN } are the values for the hidden states • K : {k1…kM } are the values for the observations 6 HMM Formalism S A S B K • • • • K A S B K A S A S B K K {S, K, P, A, B} P = {pi} are the initial state probabilities A = {aij} are the state transition probabilities B = {bik} are the observation state probabilities 7 Inference in an HMM • Probability Estimation: Compute the probability of a given observation sequence • Decoding: Given an observation sequence, compute the most likely hidden state sequence • Parameter Estimation: Given an observation sequence, find a model that most closely fits the observation 8 Probability Estimation o1 ot-1 ot ot+1 oT Given an observation sequence and a model, compute the probability of the observation sequence O = (o1...oT ), = ( A, B, P) ComputeP(O | ) 9 Probability Estimation x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT P(O | X , ) = bx1o1 bx2o2 ...bxT oT 10 Probability Estimation x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT P(O | X , ) = bx1o1 bx2o2 ...bxT oT P( X | ) = p x1 ax1x2 ax2 x3 ...axT 1xT 11 Probability Estimation x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT P(O | X , ) = bx1o1 bx2o2 ...bxT oT P( X | ) = p x1 ax1x2 ax2 x3 ...axT 1xT P(O, X | ) = P(O | X , ) P( X | ) 12 Probability Estimation x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT P(O | X , ) = bx1o1 bx2o2 ...bxT oT P( X | ) = p x1 ax1x2 ax2 x3 ...axT 1xT P(O, X | ) = P(O | X , ) P( X | ) P(O | ) = P(O | X , ) P( X | ) X 13 Probability Estimation x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT P(O | ) = p { x1 ...xT } T 1 b x1 x1o1 Pa t =1 b xt xt 1 xt 1ot 1 14 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT • Special structure gives us an efficient solution using dynamic programming. • Intuition: Probability of the first t observations is the same for all possible t+1 length state sequences. • Define: i (t ) = P(o1...ot , xt = i | ) 15 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT j (t 1) = P(o1...ot 1 , xt 1 = j ) = P(o1...ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot | xt 1 = j ) P(ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot , xt 1 = j ) P(ot 1 | xt 1 = j ) 16 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT j (t 1) = P(o1...ot 1 , xt 1 = j ) = P(o1...ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot | xt 1 = j ) P(ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot , xt 1 = j ) P(ot 1 | xt 1 = j ) 17 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT j (t 1) = P(o1...ot 1 , xt 1 = j ) = P(o1...ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot | xt 1 = j ) P(ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot , xt 1 = j ) P(ot 1 | xt 1 = j ) 18 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT j (t 1) = P(o1...ot 1 , xt 1 = j ) = P(o1...ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot | xt 1 = j ) P(ot 1 | xt 1 = j ) P( xt 1 = j ) = P(o1...ot , xt 1 = j ) P(ot 1 | xt 1 = j ) 19 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT = P(o ...o , x 1 i =1...N = = i, xt 1 = j )P(ot 1 | xt 1 = j ) = j | xt = i )P( xt = i ) P(ot 1 | xt 1 = j ) P(o ...o , x = i )P( xt 1 = j | xt = i ) P(ot 1 | xt 1 = j ) 1 t 1 i =1...N = t P(o ...o , x i =1...N = t t (t )a b i =1...N i ij t 1 t jot 1 20 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT = P(o ...o , x 1 i =1...N = = i, xt 1 = j )P(ot 1 | xt 1 = j ) = j | xt = i )P( xt = i ) P(ot 1 | xt 1 = j ) P(o ...o , x = i )P( xt 1 = j | xt = i ) P(ot 1 | xt 1 = j ) 1 t 1 i =1...N = t P(o ...o , x i =1...N = t t (t )a b i =1...N i ij t 1 t jot 1 21 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT = P(o ...o , x 1 i =1...N = = i, xt 1 = j )P(ot 1 | xt 1 = j ) = j | xt = i )P( xt = i ) P(ot 1 | xt 1 = j ) P(o ...o , x = i )P( xt 1 = j | xt = i ) P(ot 1 | xt 1 = j ) 1 t 1 i =1...N = t P(o ...o , x i =1...N = t t (t )a b i =1...N i ij t 1 t jot 1 22 Forward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT = P(o ...o , x 1 i =1...N = = i, xt 1 = j )P(ot 1 | xt 1 = j ) = j | xt = i )P( xt = i ) P(ot 1 | xt 1 = j ) P(o ...o , x = i )P( xt 1 = j | xt = i ) P(ot 1 | xt 1 = j ) 1 t 1 i =1...N = t P(o ...o , x i =1...N = t t (t )a b i =1...N i ij t 1 t jot 1 23 Backward Procedure x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT i (T 1) = 1 i (t ) = P(ot ...oT | xt = i) Probability of the rest i (t ) = a b j =1...N ij iot j (t 1) of the states given the first state 24 The Solution to Estimation x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT N P(O | ) = i (T ) Forward Procedure P(O | ) = p i i (1) Backward Procedure P(O | ) = i (t ) i (t ) Combination i =1 N i =1 N i =1 25 Decoding: Best State Sequence o1 ot-1 ot ot+1 oT • Find the state sequence that best explains the observations • Viterbi algorithm P( X | O) • arg max X 26 Viterbi Algorithm x1 xt-1 j o1 ot-1 ot ot+1 oT j (t ) = max P( x1...xt 1 , o1...ot 1 , xt = j , ot ) x1 ...xt 1 The state sequence which maximizes the probability of seeing the observations to time t-1, landing in state j, and seeing the observation at time t 27 Viterbi Algorithm x1 xt-1 xt xt+1 o1 ot-1 ot ot+1 oT j (t ) = max P( x1...xt 1 , o1...ot 1 , xt = j , ot ) x1 ...xt 1 j (t 1) = max i (t )aijb jo t 1 i j (t 1) = arg max i (t )aijb jo i Recursive Computation t 1 28 Viterbi Algorithm x1 xt-1 xt xt+1 xT o1 ot-1 ot ot+1 oT Xˆ T = arg max i (T ) i Xˆ t = ^ (t 1) X t 1 Compute the most likely state sequence by working backwards P( Xˆ ) = arg max i (T ) i 29 Parameter Estimation A B o1 A B ot-1 A B ot A B B ot+1 oT • Given an observation sequence, find the model that is most likely to produce that sequence. • No analytic method => an EM algorithm (Baum-Welch) • Given a model and observation sequence, update the model parameters to better fit the observations. 30 Parameter Estimation A B A B o1 A B ot-1 ot i (t )aijb jo j (t 1) pt (i, j ) = m (t ) m (t ) t 1 A B B ot+1 oT Probability of traversing an arc m =1...N i (t ) = p (i, j) j =1...N t Probability of being in state i 31 Parameter Estimation A A B B o1 ot-1 A B ot A B B ot+1 oT pˆi = i (1) p (i, j ) = (t ) (i) = (t ) T aˆij t =1 T t =1 bˆik t i {t:ot = k } t T t =1 i Now we can compute the new estimates of the model parameters. 32 HMM Applications • Generating parameters for n-gram models • Tagging speech • Speech recognition 33 The Most Important Thing A B o1 A B ot-1 A B ot A B B ot+1 oT We can use the special structure of this model to do a lot of neat math and solve problems that are otherwise not solvable. 34 Overview • Models – HMM: Hidden Markov Model – maximum entropy Markov model – CRFs: Conditional Random Fields • Tasks – Chinese word segmentation – part-of-speech tagging – named entity recognition 35 Limitations of HMM “US official questions regulatory scrutiny of Apple” • Problem 1: HMMs only use word identity. It cannot use richer representations. – Apple is capitalized. • MEMM Solution: Use more descriptive features – ( b0:Is-capitalized, b1: Is-in-plural, b2: Has-wordnet-antonym, b3:Is-“the” etc) – Real valued features can also be handled. • Here features are pairs < b, s >: b is feature of observation and s is destination state e.g. <Is-capitalized, Company> • Feature function: if b(ot ) is true and s = st f b,s (ot ,st ) = 0 otherwise e.g. f <Is-capitalized,Company>(“Apple”, Company) = 1. 36 HMMs vs. MEMMs (I) HMMs P( s | s '), P(o | s) MEMMs P(s | s ', o) | S | distributions : Ps (s | o) 37 HMMs vs. MEMMs (II) HMMs αt(s) the probability of producing o1, . . . , ot and being in s at time t. t 1 ( s ) = sS t ( s ') P( s | s ') P(ot 1 | s) MEMMs αt(s) the probability of being in s at time t given o1, . . . , ot . t 1 ( s ) = sS t ( s ') Ps ( s | ot 1 ) δt(s) the probability of the best path δt(s) the probability of the best for producing o1, . . . , ot and being path that reaches s at time t given o1, . . . , ot . in s at time t. t 1 (s) = max sS t (s ') P(s | s ') P(ot 1 | s) t 1 (s) = max sS t (s ') Ps (s | ot 1 ) 38 Maximum Entropy •Problem 2: • HMMs are trained to maximize the likelihood of the training set. Generative, joint distribution. • But they solve conditional problems (observations are given). • MEMM Solution: Maximum Entropy (duh). • Idea: Use the least biased hypothesis, subject to what is known. • Constraints: The expectation Ei of feature i in the learned distribution should be the same as its mean Fi on the training set. For every state s0 and feature i: 1 Fi = kn =1, sk = s fi (ok , s ') ns 1 Ei = kn =1, sk = s sS Ps ( s | ok ) fi (ok , s ') ns 39 More on MEMMs • It turns out that the maximum entropy distribution is unique and has an exponential form: Ps (s | o) = 1 exp( i fi (o, s)) Z (o, s ') i features • We can estimate λi with Generalized Iterative Scaling. – – – – Adding a feature x : f x (o, s) = C fi (o, s) does not affect the solution. i Compute Fi. (0) Set i = 0 Compute current expectation Ei( j ) of feature i from model. ( j 1) i = ( j) i Fi 1 log( ( j ) ) C Ei 40 Extensions • We can train even when the labels are not known using EM. – E step: determine most probable state sequence and compute Fi. – M step: GIS. • We can reduce the number of parameters to estimate by moving the previous state in the features: “Subject-is-female”, “Previous-wasquestion”, “Is-verb-and-no-noun-yet”. • We can even add features regarding actions in a reinforcement learning setting: “Slow-vehicle-encountered-and-steer-left”. • We can mitigate data sparseness problems by simplifying the model: 1 P ( s | s ' , o) = P ( s | s ' ) exp( i f i (o, s)) Z (o, s' ) i 41 Overview • Models – HMM: Hidden Markov Model – maximum entropy Markov model – CRFs: Conditional Random Fields • Tasks – Chinese word segmentation – part-of-speech tagging – named entity recognition 42 CRFs as Sequence Labeling Tool • Conditional random fields (CRFs) are a statistical sequence modeling framework first introduced to the field of natural language processing (NLP) to overcome label-bias problem. • John Lafferty, A. McCallum and F. Pereira. 2001. Conditional Random Field: Probabilistic Models for Segmenting and Labeling Sequence Data. In Proceedings of the Eighteenth International Conference on Machine Learning, 282-289. June 28-July 01, 2001 43 Sequence Segmenting and Labeling • Goal: mark up sequences with content tags • Application in computational biology – – – – DNA and protein sequence alignment Sequence homolog searching in databases Protein secondary structure prediction RNA secondary structure analysis • Application in computational linguistics & computer science – Text and speech processing, including topic segmentation, part-of-speech (POS) tagging – Information extraction – Syntactic disambiguation 44 Example: Protein secondary structure prediction Conf: 977621015677468999723631357600330223342057899861488356412238 Pred: CCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEHHCC AA: EKKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLG 10 20 30 40 50 60 Conf: 855764222454123478985100010478999999874033445740023666631258 Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCC AA: RPKGIPMAQAGKIRSTGGVPGFQQKATLKPVAKRLSELLLRPVTFAPDCLNAADVVSKMS 70 80 90 100 110 120 Conf: 874688611002343044310017899999875053355212244334552001322452 Pred: CCCEEEECCCHHHHHHCCCCCHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCHHHH AA: PGDVVLLENVRFYKEEGSKKAKDREAMAKILASYGDVYISDAFGTAHRDSATMTGIPKIL 130 140 150 160 170 180 45 HMMs as Generative Models • Hidden Markov models (HMMs) • Assign a joint probability to paired observation and label sequences – The parameters typically trained to maximize the joint likelihood of train examples 46 HMMs as Generative Models (cont’d) • Difficulties and disadvantages – Need to enumerate all possible observation sequences – Not practical to represent multiple interacting features or long-range dependencies of the observations – Very strict independence assumptions on the observations 47 Conditional Models • Conditional probability P(label sequence y | observation sequence x) rather than joint probability P(y, x) – Specify the probability of possible label sequences given an observation sequence • Allow arbitrary, non-independent features on the observation sequence X • The probability of a transition between labels may depend on past and future observations – Relax strong independence assumptions in generative models 48 Discriminative Models Maximum Entropy Markov Models (MEMMs) • • Exponential model Given training set X with label sequence Y: – Train a model θ that maximizes P(Y|X, θ) – For a new data sequence x, the predicted label y maximizes P(y|x, θ) – Notice the per-state normalization 49 MEMMs (cont’d) • MEMMs have all the advantages of Conditional Models • Per-state normalization: all the mass that arrives at a state must be distributed among the possible successor states (“conservation of score mass”) • Subject to Label Bias Problem – Bias toward states with fewer outgoing transitions 50 Label Bias Problem • Consider this MEMM: • P(1 and 2 | ro) = P(2 | 1 and ro)P(1 | ro) = P(2 | 1 and o)P(1 | r) P(1 and 2 | ri) = P(2 | 1 and ri)P(1 | ri) = P(2 | 1 and i)P(1 | r) • Since P(2 | 1 and x) = 1 for all x, P(1 and 2 | ro) = P(1 and 2 | ri) In the training data, label value 2 is the only label value observed after label value 1 Therefore P(2 | 1) = 1, so P(2 | 1 and x) = 1 for all x • However, we expect P(1 and 2 | ri) to be greater than P(1 and 2 | ro). • Per-state normalization does not allow the required expectation •http://wing.comp.nus.edu.sg/pipermail/graphreading/2005-September/000032.html •http://hi.baidu.com/%BB%F0%D1%BF_ayouh/blog/item/338f13510d38e8441038c250.html 51 Solve the Label Bias Problem • Change the state-transition structure of the model – Not always practical to change the set of states • Start with a fully-connected model and let the training procedure figure out a good structure – Prelude the use of prior, which is very valuable (e.g. in information extraction) 52 Random Field 53 Conditional Random Fields (CRFs) • CRFs have all the advantages of MEMMs without label bias problem – MEMM uses per-state exponential model for the conditional probabilities of next states given the current state – CRF has a single exponential model for the joint probability of the entire sequence of labels given the observation sequence • Undirected acyclic graph • Allow some transitions “vote” more strongly than others depending on the corresponding observations 54 Definition of CRFs X is a random variable over data sequences to be labeled Y is a random variable over corresponding label sequences 55 Example of CRFs 56 Graphical comparison among HMMs, MEMMs and CRFs HMM MEMM CRF 57 Conditional Distribution If the graph G = (V, E) of Y is a tree, the conditional distribution over the label sequence Y = y, given X = x, by fundamental theorem of random fields is: p (y | x) exp k f k (e, y |e , x) k g k (v, y |v , x) vV ,k eE,k x is a data sequence y is a label sequence v is a vertex from vertex set V = set of label random variables e is an edge from edge set E over V fk and gk are given and fixed. gk is a Boolean vertex feature; fk is a Boolean edge feature k is the number of features = (1, 2 , , n ; 1, 2 , , n ); k and k are parameters to be estimated y|e is the set of components of y defined by edge e y|v is the set of components of y defined by vertex v 58 Conditional Distribution (cont’d) • CRFs use the observation-dependent normalization Z(x) for the conditional distributions: 1 p (y | x) = exp k f k (e, y |e , x) k g k (v, y |v , x) Z (x) vV ,k eE,k Z(x) is a normalization over the data sequence x 59 Decoding: To label an unseen sequence We compute the most likely labeling Y* as follows by dynamic programming (for efficient computation) Y * = arg maxY P(Y | X ) 60 Complexity Estimation • The time complexity of an iteration of parameter estimation of L-BFGS algorithm is • O(L2NMF) • where L and N are, respectively, the numbers of labels and sequences (sentences), • M is the average length of sequences, and • F is the average number of activated features of each labelled clique. 61 CRF++: a CRFs Package • CRF++ is a simple, customizable, and open source implementation of Conditional Random Fields (CRFs) for segmenting/labeling sequential data. • http://crfpp.sourceforge.net/ • Requirements – C++ compiler (gcc 3.0 or higher) • How to make – – – – % ./configure % make % su # make install 62 CRF++ • Feature template representation and input file format 63 CRF++ • training • % crf_learn -f 3 -c 1.5 template_file train_file model_file • test • % crf_test -m model_file test_files 64 Summary • Discriminative models are prone to the label bias problem • CRFs provide the benefits of discriminative models • CRFs solve the label bias problem well, and demonstrate good performance 65 Overview • Models – HMM: Hidden Markov Model – maximum entropy Markov model – CRFs: Conditional Random Fields • Tasks – Chinese word segmentation – part-of-speech tagging – named entity recognition 66 What is Chinese Word Segmentation • A special case of tokenization in natural language processing (NLP) for many languages that have no explicit word delimiters such as spaces. • Original: – 她来自苏格兰 – She comes from SU GE LAN Meaningless! • Segmented: – 她/来/自/苏格兰 – She comes from Scotland. Meaningful! 67 Learning from a Lexicon: maximal matching algorithm for word segmentation • Input – – • A lexicon is pre-defined. An unsegmented sequence The algorithm: ① Start from the first character, try to find the longest matched word in the lexicon. ② Set the next character after the above found word as the new start point. ③ If reaches the end of the sequence, the algorithm ends. ④ Otherwise, go to (1). 68 Learning from a segmented corpus: Word segmentation as labeling • 自然科学的研究不断深入 • natural science / of / research / uninterruptedly / deepen • 自然科学/的/研究/不断/深入 • BMME S BE BE BE • B: beginning, M: Middle, E: End, of a word • S: single-character word • Using CRFs as the learning model 69 CWS as Character-base Tagging: From the begging to the latest • • • • • Nianwen Xue, 2003 Chinese Word Segmentation as Character Tagging, CLCLP, Vol. 8(1), 2003 Xiaoqiang Luo, 2003 A Maximum Entropy Chinese Character-based Parser, EMNLP-2003 Hwee Tou Ng and Kin Kiat Low, 2004 Chinese Part-of Speech Tagging: One-at-a-Time or All-at-Once? Word-based or Character-Based? EMNLP-2004 Jin Kiat Low, Hwee Tou Ng, Wenyuan Guo, 2005 A Maximum Entropy Approach to Chinese Word Segmentation, The 4th SIGHAN Workshop on CLP, 2005 Huihsin Tseng, Pichuan Chang, Galen Andrew, Daniel Jurafsky, Christopher Manning, 2005 A Conditional Random Field Word Segmenter for Sighan Bakeoff 2005, The 4th SIGHAN Workshop on CLP, 2005 70 Label Set Tag set Tags Multi-character Word Reference 2-tag B, E B, BE, BEE, … Mostly for CRF 4-tag B, M, E, S S, BE, BME, BMME, … Xue/Low/MaxEnt 6-tag B, M, E, S, B2, B3 S, BE, BB2E, BB2 B3E, BB2 B3ME, … Zhao/CRF More labels, better performance for CWS … 71 Feature Template Set C-1,C0,C1,C-1C0,C0C1,C-1C1, Where C-1 C0 C1 is previous, current and next character 72 Overview • Models – HMM: Hidden Markov Model – maximum entropy Markov model – CRFs: Conditional Random Fields • Tasks – Chinese word segmentation – part-of-speech tagging – named entity recognition 73 Parts of Speech • Generally speaking, the “grammatical type” of word: – Verb, Noun, Adjective, Adverb, Article, … • We can also include inflection: – Verbs: Tense, number, … – Nouns: Number, proper/common, … – Adjectives: comparative, superlative, … –… • Most commonly used POS sets for English have 5080 different tags 74 BNC Parts of Speech • Nouns: NN0 Common noun, neutral for number (e.g. aircraft NN1 Singular common noun (e.g. pencil, goose, time NN2 Plural common noun (e.g. pencils, geese, times NP0 Proper noun (e.g. London, Michael, Mars, IBM • Pronouns: PNI Indefinite pronoun (e.g. none, everything, one PNP Personal pronoun (e.g. I, you, them, ours PNQ Wh-pronoun (e.g. who, whoever, whom PNX Reflexive pronoun (e.g. myself, itself, ourselves 75 • Verbs: VVB finite base form of lexical verbs (e.g. forget, send, live, return VVD past tense form of lexical verbs (e.g. forgot, sent, lived VVG -ing form of lexical verbs (e.g. forgetting, sending, living VVI infinitive form of lexical verbs (e.g. forget, send, live, return VVN past participle form of lexical verbs (e.g. forgotten, sent, lived VVZ -s form of lexical verbs (e.g. forgets, sends, lives, returns VBB present tense of BE, except for is …and so on: VBD VBG VBI VBN VBZ VDB finite base form of DO: do …and so on: VDD VDG VDI VDN VDZ VHB finite base form of HAVE: have, 've …and so on: VHD VHG VHI VHN VHZ VM0 Modal auxiliary verb (e.g. will, would, can, could, 'll, 'd) 76 • Articles AT0 Article (e.g. the, a, an, no) DPS Possessive determiner (e.g. your, their, his) DT0 General determiner (this, that) DTQ Wh-determiner (e.g. which, what, whose, whichever) EX0 Existential there, i.e. occurring in “there is…” or “there are…” • Adjectives AJ0 Adjective (general or positive) (e.g. good, old, beautiful) AJC Comparative adjective (e.g. better, older) AJS Superlative adjective (e.g. best, oldest) • Adverbs AV0 General adverb (e.g. often, well, longer (adv.), furthest. AVP Adverb particle (e.g. up, off, out) AVQ Wh-adverb (e.g. when, where, how, why, wherever) 77 • Miscellaneous: CJC Coordinating conjunction (e.g. and, or, but) CJS Subordinating conjunction (e.g. although, when) CJT The subordinating conjunction that CRD Cardinal number (e.g. one, 3, fifty-five, 3609) ORD Ordinal numeral (e.g. first, sixth, 77th, last) ITJ Interjection or other isolate (e.g. oh, yes, mhm, wow) POS The possessive or genitive marker 's or ' TO0 Infinitive marker to PUL Punctuation: left bracket - i.e. ( or [ PUN Punctuation: general separating mark - i.e. . , ! , : ; - or ? PUQ Punctuation: quotation mark - i.e. ' or " PUR Punctuation: right bracket - i.e. ) or ] XX0 The negative particle not or n't ZZ0 Alphabetical symbols (e.g. A, a, B, b, c, d) 78 Task: Part-Of-Speech Tagging • Goal: Assign the correct part-of-speech to each word (and punctuation) in a text. • Example: Two old men bet on the game CRD AJ0 NN2 VVD PP0 AT0 NN1 . PUN • Learn a local model of POS dependencies, usually from pre-tagged data • No parsing 79 Hidden Markov Models • Assume: POS (state) sequence generated as timeinvariant random process, and each POS randomly generates a word (output symbol) 0.2 AJ0 0.2 “a” 0.6 0.3 0.3 NN2 0.5 AT0 “the” 0.4 “cats” “men” 0.9 0.5 NN1 0.1 “cat” “bet” 80 Definition of HMM for Tagging • Set of states – all possible tags • Output alphabet – all words in the language • State/tag transition probabilities • Initial state probabilities: the probability of beginning a sentence with a tag t (t0t) • Output probabilities – producing word w at state t • Output sequence – observed word sequence • State sequence – underlying tag sequence 81 HMMs For Tagging • First-order (bigram) Markov assumptions: – Limited Horizon: Tag depends only on previous tag P(ti+1 = tk | t1=tj1,…,ti=tji) = P(ti+1 = tk | ti = tj) – Time invariance: No change over time P(ti+1 = tk | ti = tj) = P(t2 = tk | t1 = tj) = P(tj tk) • Output probabilities: – Probability of getting word wk for tag tj: P(wk | tj) – Assumption: Not dependent on other tags or words! 82 Combining Probabilities • Probability of a tag sequence: P(t1t2…tn) = P(t1)P(t1t2)P(t2t3)…P(tn-1tn) Assume t0 – starting tag: = P(t0t1)P(t1t2)P(t2t3)…P(tn-1tn) • Prob. of word sequence and tag sequence: P(W,T) = Pi P(ti-1ti) P(wi | ti) 83 Training from Labeled Corpus • Labeled training = each word has a POS tag • Thus: PMLE(tj) = C(tj) / N PMLE(tjtk) = C(tj, tk) / C(tj) PMLE(wk | tj) = C(tj:wk) / C(tj) • Smoothing can be applied. 84 Viterbi Tagging • Most probable tag sequence given text: T* = arg maxT Pm(T | W) = arg maxT Pm(W | T) Pm(T) / Pm(W) (Bayes’ Theorem) = arg maxT Pm(W | T) Pm(T) (W is constant for all T) = arg maxT Pi[m(ti-1ti) m(wi | ti) ] = arg maxT i log[m(ti-1ti) m(wi | ti) ] • Exponential number of possible tag sequences – use dynamic programming for efficient computation 85 w1 t1 -2.3 t0 w2 -1.7 t1 -3 -6 -0.3 -1.7 2 t -1.7 t1 -7.3 -0.3 t2 -4.7 -3.4 -1.3 -1 w3 t2 -10.3 -1.3 t3 -2.7 t3 -6.7 t3 -9.3 -log m t1 t2 t3 -log m w1 w2 w3 t0 2.3 1.7 1 t1 0.7 2.3 2.3 t1 1.7 1 2.3 t2 1.7 0.7 3.3 t2 0.3 3.3 3.3 t3 1.7 1.7 1.3 t3 1.3 1.3 2.3 86 Viterbi Algorithm 1. 2. 3. 4. 5. D(0, START) = 0 for each tag t != START do: D(1, t) = - for i 1 to N do: for each tag tj do: D(i, tj) maxk D(i-1,tk) + lm(tktj) + lm(wi|tj) Record best(i,j)=k which yielded the max log P(W,T) = maxj D(N, tj) Reconstruct path from maxj backwards where: lm(.) = log m(.) and D(i, tj) – max joint probability of state and word sequences till position i, ending at tj. Complexity: O(Nt2 N) 87 Overview • Models – HMM: Hidden Markov Model – maximum entropy Markov model – CRFs: Conditional Random Fields • Tasks – Chinese word segmentation – part-of-speech tagging – named entity recognition 88 Hidden Markov Model (HMM) based NERC System • Named Entity Recognition and Classification System • HMM– Statistical construct used to solve classification problems, having an inherent state sequence representation – Transition probability: Probability of traveling between two given states – A set of output symbols (also known as observation) emitted by the process – Emitted symbol depends on the probability distribution of the particular state – Output of the HMM: Sequence of output symbols – Exact state sequence corresponding to a particular observation sequence is unknown (i.e., hidden) – Simple language model (n-gram) for NE tagging • Uses very little amount of knowledge about the language, apart from simple context information 89 HMM based NERC System (Contd..) HMM based NERC Architecture 90 HMM based NERC System (Contd..) • Components of HMM based NERC system – Language model • Represented by the model parameters of HMM • Model parameters estimated based on the labeled data during learning – Possible class module • Consists of a list of lexical units associated with the list of 17 tags – NE disambiguation algorithm • Input: List of lexical units with the associated list of possible tags • Output: Output tag for each lexical unit using the encoded information from the language model • Decides the best possible tag assignment for every word in a sentence according to the language model • Viterbi algorithm (Viterbi, 1967) – Unknown word handling • Viterbi algorithm (Viterbi, 1967) assigns some tags to unknown words • variable length NE suffixes • Lexicon (Ekbal and Bandyopadhyay, 2008d) 91 HMM based NERC System (Contd..) • Problem of NE tagging Let W be a sequence of words W = w1 , w2 , … , wn Let T be the corresponding NE tag sequence T = t1 , t2 , … , tn Task : Find T which maximizes P ( T | W ) T’ = argmaxT P ( T | W ) 92 HMM based NERC System (Contd..) By Bayes Rule, P(T|W)=P(W|T)*P(T)/P(W) T’ = argmaxT P ( W | T ) * P ( T ) Models – Fisrt order model (Bigram): The probability of a tag depends only on the previous tag – Second order model (Trigram): The probability of a tag depends on the previous two tags Transition Probability Bigram P ( T ) = P ( t1 ) * P ( t2 | t1 ) * P ( t3 | t1 t2 ) …… * P ( tn | t1 … tn-1 ) Trigram P ( T ) = P ( t1 ) * P ( t2 | t1 ) * P ( t3 | t1 t2 ) …… * P ( tn | tn-2 tn-1 ) P ( T ) = P ( t1 | $ ) * P ( t2 | $ t1 ) * P ( t3 | t1 t2 ) …… * P ( tn | tn-2 tn-1 ) Where, $ dummy tag used to represent the beginning of a sentence 93 HMM based NERC System (Contd..) • Estimation of unigram, bigram and trigram probabilities from the training corpus freq(t3 ) Unigram : P(t3 ) = N freq(t2 , t3 ) Bigram : P(t3 | t2 ) = freq(t2 ) • Emission Probability Trigram : P(t3 | t1 , t2 ) = freq(t1 , t2 , t3 ) freq(t1 , t2 ) P(W | T ) P(w1 | t1 )* P(w2 | t2 )*... * P(wn | tn ) • Estimation : P( wi | ti ) = freq( wi , ti ) freq(ti ) 94 HMM based NERC System (Contd..) Context Dependency (Modification) – To make Markov model powerful, introduce a 1st order context dependent feature P(W | T ) P(w1 | $, t1 )* P(w2 | t1, t2 )*...* P(wn | tn1 , tn ) freq( wi , ti 1 , ti ) P( wi | ti 1 , ti ) = freq(ti 1 , ti ) 95 2nd order Hidden Markov Model 96 2nd order Hidden Markov Model (Proposed) 97 HMM based NERC System (Contd..) • Why Smoothing? – All events may not be encountered in the limited training corpus – Insufficient instances for each bigram or trigram to reliably estimate the probability – Setting a probability to zero has an undesired effect • Procedure – Transition probability : P(tn | tn2 , tn1 ) = 1P(tn ) 2 P(tn | tn1 ) 3 P(tn | tn2 , tn1 ) 1 2 3 = 1 – Emission probability : P(wi | ti 1 , ti ) = 1P(wi | ti ) 2 P(wi | ti 1 , ti ) 1 2 = 1 – Calculation of λs and Өs (Brants, 2000) 98 HMM based NERC System (Contd..) Handling of unknown words Viterbi algorithm (Viterbi, 1967) attempts to assign a tag to the unknown words P( wi | ti ) P( fi | ti ) Calculated based on the features of unknown word Suffixes: Probability distribution of a particular suffix with respect to specific NE tags is generated from all words in the training set that share the same suffix Variable length person name suffixes (e.g., - bAbu[-babu], -dA [-da] , di[-di] etc) Variable length location name suffixes (e.g., - lYAnd[-land], -pur[-pur], -liYA[-lia]) etc) Lexicon Lexicon contains the root words and their basic POS information Unknown word that is found to appear in the lexicon is most likely not a NE 99 Supervised NERC Systems (ME, CRF and SVM) • Limitations of HMM – Use of only local features may not work well – Simple HMM models do not work well when large data are not used to estimate the model parameters – Incorporating a diverse set features in an HMM based NE tagger is difficult and complicates the smoothing • Solution: – Maximum Entropy (ME) model, Conditional Random Field (CRF) or Support Vector Machine (SVM) – ME, CRF or SVM can make use of rich feature information • ME model – Very flexible method of statistical modeling – A combination of several features can be easily incorporated – Careful feature selection plays a crucial role – Does not provide a method for automatic selection of useful features – Features selected using heuristics – Adding arbitrary features may result in overfitting 100 Supervised NERC Systems (ME, CRF and SVM) • CRF – CRF does not require careful feature selection in order to avoid overfitting – Freedom to include arbitrary features – Ability of feature induction to automatically construct the most useful feature combinations – Conjunction of features – Infeasible to incorporate all possible conjunction features due to overflow of memory – Good to handle different types of data • SVM – Predict the classes depending upon the labeled word examples only – Predict the NEs based on feature information of words collected in a predefined window size only – Can not handle the NEs outside tokens – Achieves high generalization even with training data of a very high dimension – Can handle non-linear feature spaces with 101 Named Entity Features • Language Independent Features – Can be applied for NERC in any language • Language Dependent Features – Generated from the language specific resources like gazetteers and POS taggers – Indian languages are resource-constrained – Creation of gazetteers in resource-constrained environment requires a priori knowledge of the language – POS information depends on some language specific phenomenon such as person, number, tense, gender etc – POS tagger (Ekbal and Bandyopadhyay, 2008d) makes use of the several language specific resources such as lexicon, inflection list and a NERC system to improve its performance • Language dependent features improve system performance 102 Language Independent Features – Context Word: Preceding and succeeding words – Word Suffix • Not necessarily linguistic suffixes • Fixed length character strings stripped from the endings of words • Variable length suffix -binary valued feature – Word Prefix • Fixed length character strings stripped from the beginning of the words – Named Entity Information: Dynamic NE tag (s) of the previous word (s) – First Word (binary valued feature): Check whether the current token is the first word in the sentence 103 Language Independent Features (Contd..) • Length (binary valued): Check whether the length of the current word less than three or not (shorter words rarely NEs) • Position (binary valued): Position of the word in the sentence • Infrequent (binary valued): Infrequent words in the training corpus most probably NEs • Digit features: Binary-valued – Presence and/or the exact number of digits in a token • CntDgt : Token contains digits • FourDgt: Token consists of four digits • TwoDgt: Token consists of two digits • CnsDgt: Token consists of digits only 104 Language Independent Features (Contd..) – Combination of digits and punctuation symbols • CntDgtCma: Token consists of digits and comma • CntDgtPrd: Token consists of digits and periods – Combination of digits and symbols • CntDgtSlsh: Token consists of digit and slash • CntDgtHph: Token consists of digits and hyphen • CntDgtPrctg: Token consists of digits and percentages – Combination of digit and special symbols • CntDgtSpl: Token consists of digit and special symbol such as $, # etc. 105 Language dependent Features (Contd..) – Part of Speech (POS) Information: POS tag(s) of the current and/or the surrounding word(s) • SVM-based POS tagger (Ekbal and Bandyopadhyay, 2008b) • Accuracy=90.2% • SVM based NER POS tagger developed with a fine-grained tagset of 27 tags • ME and CRF based NERC Coarse-grained POS tagger – Nominal, PREP (Postpositions) and Other – Gazetteer based features (binary valued): Several features extracted from the gazetteers 106 ME based NERC System (Contd..) •Language model: Represented by ME model parameters •Possible class module: Consists of a list of lexical units for each word associated with the list of 17 tags •NE disambiguation: Decides the most probable tag sequence for a given word sequence • beam search algorithm •Elimination of inadmissible sequences: Removes the inadmissible tag sequences from the output of the ME model Tool: C++ based ME Package (http://homepages.inf.ed.ac.uk/s0450736/software/m axent/maxent-20061005.tar.bz2) 107 ME based NERC System • Elimination of Inadmissible Tag Sequences – Inadmissible tag sequence (e.g., B-PER followed by LOC) – Transition probability 1, if the sequence is admissible P(ci | c j ) = 0, otherwise – Probability of the classes assigned to the words in a sentence ‘s’ in a document ‘D’ defined as : n P(c1 ,..., cn | s, D) = P(ci | s, D)* P(ci | ci 1 ) i =1 where P(ci | s, D) is determined by the maximum entropy classifier 108 CRF based NERC System • Language model: Represented by CRF model parameters • Possible class module: Consists of a list of lexical units for each word associated with the list of 17 tags • NE disambiguation: Decides the most probable tag sequence for a given word sequence • Forward Viterbi and backword A* search algorithm (Rabiner, 1989) for disambiguation Tool: C++ based CRF++ package (http://crfpp.sourceforge.net ) • Elimination of inadmissible sequences: Removes the inadmissible tag sequences from the output of the CRF model (Same as ME model) 109 CRF based NERC System (Contd..) • Feature Template: Feature represented in terms of feature template Feature template used in the experiment 110 SVM based NERC System •Language model: Represented by SVM model parameters •Possible class module: Considers any of the 17 NE tags to each word •NE disambiguation: Beam search (Selection of beam width (i.e., N) is very important, as larger beam width does not always give a significant improvement in performance) •Elimination of inadmissible tag sequences: Same as ME and CRF Training: YamCha toolkit (http://chasen-org/~taku/software/yamcha/) Classification: TinySVM-0.07 (http://cl.aist-nara.ac.jp/~takuku/ software/TinySVM ) one vs rest and pairwise multi-class decision methods 111 Polynomial kernel function SVM based NERC System (Contd..) Feature representation in SVM Features •Features Surrounding context, such as words, their lexical features, and the various orthographic wordlevel features as well as the NE labels •wi word appearing at the ith position •pi POS feature of wi, •ti NE label for the ith word •Reverse parsing direction is possible (from right to left) •Models of SVM: •SVM-F: Parses from left to right •SVM-B: Parses from right to left 112 Best Feature Sets for ME, CRF and SVM Model Feature ME Word, Context (Preceding one and following one word), Prefixes and suffixes of length up to three characters of the current word only, Dynamic NE tag of the previous word, First word of the sentence, Infrequent word, Length of the word, Digit features CRF Word, Context (Preceding two and following two words), Prefixes and suffixes of length up to three characters of the current word only, Dynamic NE tag of the previous word, First word of the sentence, Infrequent word, Length of the word, Digit features SVM-F Word, Context (Preceding three and following two words), Prefixes and suffixes of length up to three characters of the current word only, Dynamic NE tag of the previous two words, First word of the sentence, Infrequent word, Length of the word, Digit features SVM-B Word, Context (Preceding three and following two words), Prefixes and suffixes of length up to three characters of the current word only, Dynamic NE tag of the previous two words, First word of the sentence, Infrequent word, Length of the word, Digit features Best Feature set Selection: Training with language independent features and tested with the development set 113 Language Dependent Evaluation (ME, CRF and SVM) • Observations: Classifiers trained with best set of language independent as well as language dependent features POS information of the words are very effective Coarse-grained POS tagger (Nominal, PREP and Other) for ME and CRF Fine-grained POS tagger (developed with 27 POS tags) for SVM based Systems Best Performance of ME: POS information of the current word only (an improvement of 2.02% F-Score ) Best Performance of CRF: POS information of the current, previous and next words (an improvement of 3.04% F-Score ) Best Performance of SVM: POS information of the current, previous and next words (an improvement of 2.37% F-Score in SVM-F and 2.32% in SVM-B ) NE suffixes, Organization suffix words, person prefix words, designations and common location words are more effective than other gazetteers 114 Reference • • • • • HMM http://www-nlp.stanford.edu/fsnlp/hmm-chap/blei-hmm-ch9.ppt MEMM www.cs.cornell.edu/courses/cs778/2006fa/lectures/05-memm.pdf CRFs web.engr.oregonstate.edu/~tgd/classes/539/slides/Shen-CRF.ppt PoS-tagging cs.haifa.ac.il/~shuly/teaching/04/statnlp/pos-tagging.ppt NER www.cl.uni-heidelberg.de/colloquium/docs/ekbal_abstract.pdf 115 Assignment • • • • • .8 .15 .05 States: {Ssunny,Srainy ,Ssnowy } A = .38 .6 .02 Observations: {Oskirt ,Ocoat ,Oumbrella } .75 .05 .2 State transition probabilities: .6 .3 .1 Emission probability: B = .05 .3 .65 Initial state distribution: p = (.7 .25 .05) 0 .5 .5 • Given O: Ocoat Ocoat Oumbrella Oumbrella Oskirt Oumbrella Oumbrella • What is the probability that the given sequence appears? (forward procedure) • What is the most possible weather states given the observations? 116